RegulonDB RegulonDB 10.9: Amino acid Sequence
CspA family stress protein CspC Amino Acid Sequence


Size: 69

Fasta

 

>stress protein, member of the CspA family E. coli K12. Version NC_000913.3 GI:556503834
MAKIKGQVKWFNESKGFGFITPADGSKDVFVHFSAIQGNGFKTLAEGQNVEFEIQDGQKG
PAAVNVTAI
              
                            

Download fasta file
RegulonDB