RegulonDB RegulonDB 10.9: Amino acid Sequence
23S rRNA m1G745 methyltransferase Amino Acid Sequence


Size: 269

Fasta

 

>23S rRNA m1G745 methyltransferase E. coli K12. Version NC_000913.3 GI:556503834
MSFSCPLCHQPLSREKNSYICPQRHQFDMAKEGYVNLLPVQHKRSRDPGDSAEMMQARRA
FLDAGHYQPLRDAIVAQLRERLDDKATAVLDIGCGEGYYTHAFADALPEITTFGLDVSKV
AIKAAAKRYPQVTFCVASSHRLPFSDTSMDAIIRIYAPCKAEELARVVKPGGWVITATPG
PRHLMELKGLIYNEVHLHAPHAEQLEGFTLQQSAELCYPMRLRGDEAVALLQMTPFAWRA
KPEVWQTLAAKEVFDCQTDFNIHLWQRSY
              
                            

Download fasta file
RegulonDB