RegulonDB RegulonDB 10.9: Amino acid Sequence
F- channel Amino Acid Sequence


Size: 127

Fasta

 

>F- channel E. coli K12. Version NC_000913.3 GI:556503834
MLQLLLAVFIGGGTGSVARWLLSMRFNPLHQAIPLGTLTANLIGAFIIGIGFAWFSRMTN
IDPVWKVLITTGFCGGLTTFSTFSAEVVFLLQEGRFGWALLNVFVNLLGSFAMTALAFWL
FSASTAH
              
                            

Download fasta file
RegulonDB