RegulonDB RegulonDB 10.10: Amino acid Sequence
2,3-diketo-L-gulonate reductase Amino Acid Sequence


Size: 332

Fasta

 

>2,3-diketo-L-gulonate reductase E. coli K12. Version NC_000913.3 GI:556503834
MKVTFEQLKAAFNRVLISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQQLENGD
IIPDAQPKRITSLGAIEQWDAQRSIGNLTAKKMMDRAIELAADHGIGLVALRNANHWMRG
GSYGWQAAEKGYIGICWTNSIAVMPPWGAKECRIGTNPLIVAIPSTPITMVDMSMSMFSY
GMLEVNRLAGRQLPVDGGFDDEGNLTKEPGVIEKNRRILPMGYWKGSGMSIVLDMIATLL
SDGASVAEVTQDNSDEYGISQIFIAIEVDKLIDGPTRDAKLQRIMDYVTSAERADENQAI
RLPGHEFTTLLAENRRNGITVDDSVWAKIQAL
              
                            

Download fasta file
RegulonDB