RegulonDB RegulonDB 10.10: Amino acid Sequence
L-xylulose kinase Amino Acid Sequence


Size: 498

Fasta

 

>L-xylulose kinase E. coli K12. Version NC_000913.3 GI:556503834
MTQYWLGLDCGGSWLKAGLYDREGREAGVQRLPLCALSPQPGWAERDMAELWQCCMAVIR
ALLTHSGVSGEQIVGIGISAQGKGLFLLDKNDKPLGNAILSSDRRAMEIVRRWQEDGIPE
KLYPLTRQTLWTGHPVSLLRWLKEHEPERYAQIGCVMMTHDYLRWCLTGVKGCEESNISE
SNLYNMSLGEYDPCLTDWLGIAEINHALPPVVGSAEICGEITAQTAALTGLKAGTPVVGG
LFDVVSTALCAGIEDEFTLNAVMGTWAVTSGITRGLRDGEAHPYVYGRYVNDGEFIVHEA
SPTSSGNLEWFTAQWGEISFDEINQAVASLPKAGGDLFFLPFLYGSNAGLEMTSGFYGMQ
AIHTRAHLLQAIYEGVVFSHMTHLNRMRERFTDVHTLRVTGGPAHSDVWMQMLADVSGLR
IELPQVEETGCFGAALAARVGTGVYHNFSEAQRDLRHPVRTLLPDMTAHQLYQKKYQRYQ
HLIAALQGFHARIKEHTL
              
                            

Download fasta file
RegulonDB