RegulonDB RegulonDB 10.9: Amino acid Sequence
putative rRNA methyltransferase Amino Acid Sequence


Size: 228

Fasta

 

>putative rRNA methyltransferase E. coli K12. Version NC_000913.3 GI:556503834
MRITIILVAPARAENIGAAARAMKTMGFSDLRIVDSQAHLEPATRWVAHGSGDIIDNIKV
FPTLAESLHDVDFTVATTARSRAKYHYYATPVELVPLLEEKSSWMSHAALVFGREDSGLT
NEELALADVLTGVPMVADYPSLNLGQAVMVYCYQLATLIQQPAKSDATADQHQLQALRER
AMTLLTTLAVADDIKLVDWLQQRLGLLEQRDTAMLHRLLHDIEKNITK
              
                            

Download fasta file
RegulonDB