RegulonDB RegulonDB 10.9: Amino acid Sequence
inactive recombination-promoting nuclease-like protein RpnE Amino Acid Sequence


Size: 299

Fasta

 

>inactive recombination-promoting nuclease-like protein RpnE E. coli K12. Version NC_000913.3 GI:556503834
MTESTTSSPHDAVFKTFMFTPETARDFLEIHLPEPLRKLCNLQTLRLEPTSFIEKSLRAY
YSDVLWSVETSDGDGYIYCVIEHQSSAEKNMAFRLMRYATAAMQRHQDKGYDRVPLVVPL
LFYHGETSPYPYSLNWLDEFDDPQLARQLYTEAFLLVDITIVPDDEIMQHRRIALLELIQ
KHIRDRDLIGMVDRITTLLVRGFTNDSQLQTLFNYLLQCGDTSRFTRFIEEIAERSPLQK
ERLMTIAERLRQEGHQIGWQEGMHEQAIKIALRMLEQGFEREIVLATTQLTDADIPNCH
              
                            

Download fasta file
RegulonDB