RegulonDB RegulonDB 10.9: Amino acid Sequence
putative fimbrial protein YadM Amino Acid Sequence


Size: 189

Fasta

 

>putative fimbrial protein YadM E. coli K12. Version NC_000913.3 GI:556503834
MIKTTPHKIVILMGILLSPSVFATDINVEFTATVKATTCNITLTGNNVTNDGNNNYTLRI
PKMGLDKIANKTTESQADFKLVASGCSSGISWIDTTLTGNASSSSPKLIIPQSGDSSSTT
SNIGMGFKKRTTDDATFLKPNSAEKIRWSTDEMQPDKGLEMTVALRETDAGQGVPGNFRA
LATFNFIYQ
              
                            

Download fasta file
RegulonDB