RegulonDB RegulonDB 10.9: Amino acid Sequence
RNA 2',3'-cyclic phosphodiesterase Amino Acid Sequence


Size: 176

Fasta

 

>RNA 2',3'-cyclic phosphodiesterase E. coli K12. Version NC_000913.3 GI:556503834
MSEPQRLFFAIDLPAEIREQIIHWRATHFPPEAGRPVAADNLHLTLAFLGEVSAEKEKAL
SLLAGRIRQPGFTLTLDDAGQWLRSRVVWLGMRQPPRGLIQLANMLRSQAARSGCFQSNR
PFHPHITLLRDASEAVTIPPPGFNWSYAVTEFTLYASSFARGRTRYTPLKRWALTQ
              
                            

Download fasta file
RegulonDB