RegulonDB RegulonDB 10.9: Amino acid Sequence
iron-sulfur cluster insertion protein ErpA Amino Acid Sequence


Size: 114

Fasta

 

>iron-sulfur cluster insertion protein ErpA E. coli K12. Version NC_000913.3 GI:556503834
MSDDVALPLEFTDAAANKVKSLIADEDNPNLKLRVYITGGGCSGFQYGFTFDDQVNEGDM
TIEKQGVGLVVDPMSLQYLVGGSVDYTEGLEGSRFIVTNPNAKSTCGCGSSFSI
              
                            

Download fasta file
RegulonDB