RegulonDB RegulonDB 10.9: Amino acid Sequence
PF03458 family protein YadS Amino Acid Sequence


Size: 207

Fasta

 

>PF03458 family protein YadS E. coli K12. Version NC_000913.3 GI:556503834
MLVYWLDIVGTAVFAISGVLLAGKLRMDPFGVLVLGVVTAVGGGTIRDMALDHGPVFWVK
DPTDLVVAMVTSMLTIVLVRQPRRLPKWMLPVLDAVGLAVFVGIGVNKAFNAEAGPLIAV
CMGVITGVGGGIIRDVLAREIPMILRTEIYATACIIGGIVHATAYYTFSVPLETASMMGM
VVTLLIRLAAIRWHLKLPTFALDENGR
              
                            

Download fasta file
RegulonDB