RegulonDB RegulonDB 10.9: Amino acid Sequence
3-hydroxy acid dehydrogenase YdfG Amino Acid Sequence


Size: 248

Fasta

 

>3-hydroxy acid dehydrogenase E. coli K12. Version NC_000913.3 GI:556503834
MIVLVTGATAGFGECITRRFIQQGHKVIATGRRQERLQELKDELGDNLYIAQLDVRNRAA
IEEMLASLPAEWCNIDILVNNAGLALGMEPAHKASVEDWETMIDTNNKGLVYMTRAVLPG
MVERNHGHIINIGSTAGSWPYAGGNVYGATKAFVRQFSLNLRTDLHGTAVRVTDIEPGLV
GGTEFSNVRFKGDDGKAEKTYQNTVALTPEDVSEAVWWVSTLPAHVNINTLEMMPVTQSY
AGLNVHRQ
              
                            

Download fasta file
RegulonDB