RegulonDB RegulonDB 10.9: Amino acid Sequence
peptidyl-tRNA hydrolase, ribosome rescue factor Amino Acid Sequence


Size: 140

Fasta

 

>peptidyl-tRNA hydrolase, ribosome rescue factor E. coli K12. Version NC_000913.3 GI:556503834
MIVISRHVAIPDGELEITAIRAQGAGGQHVNKTSTAIHLRFDIRASSLPEYYKERLLAAS
HHLISSDGVIVIKAQEYRSQELNREAALARLVAMIKELTTEKKARRPTRPTRASKERRLA
SKAQKSSVKAMRGKVRSGRE
              
                            

Download fasta file
RegulonDB