RegulonDB RegulonDB 10.9: Amino acid Sequence
ferredoxin-like diferric-tyrosyl radical cofactor maintenance protein YfaE Amino Acid Sequence


Size: 84

Fasta

 

>ferredoxin-like diferric-tyrosyl radical cofactor maintenance protein YfaE E. coli K12. Version NC_000913.3 GI:556503834
MARVTLRITGTQLLCQDEHPSLLAALESHNVAVEYQCREGYCGSCRTRLVAGQVDWIAEP
LAFIQPGEILPCCCRAKGDIEIEM
              
                            

Download fasta file
RegulonDB