RegulonDB RegulonDB 10.9: Amino acid Sequence
flap endonuclease Amino Acid Sequence


Size: 251

Fasta

 

>flap endonuclease E. coli K12. Version NC_000913.3 GI:556503834
MAVHLLIVDALNLIRRIHAVQGSPCVETCQHALDQLIMHSQPTHAVAVFDDENRSSGWRH
QRLPDYKAGRPPMPEELHDEMPALRAAFEQRGVPCWSTSGNEADDLAATLAVKVTQAGHQ
ATIVSTDKGYCQLLSPTLRIRDYFQKRWLDAPFIDKEFGVQPQQLPDYWGLAGISSSKVP
GVAGIGPKSATQLLVEFQSLEGIYENLDAVAEKWRKKLETHKEMAFLCRDIARLQTDLHI
DGNLQQLRLVR
              
                            

Download fasta file
RegulonDB