RegulonDB RegulonDB 10.9: Amino acid Sequence
DUF2559 domain-containing protein YhfG Amino Acid Sequence


Size: 55

Fasta

 

>DUF2559 domain-containing protein YhfG E. coli K12. Version NC_000913.3 GI:556503834
MKKLTDKQKSRLWELQRNRNFQASRRLEGVEMPLVTLTAAEALARLEELRSHYER
              
                            

Download fasta file
RegulonDB