RegulonDB RegulonDB 11.1: Amino acid Sequence
metallo-β-lactamase superfamily inner membrane protein YcaI Amino Acid Sequence


Size: 754

Fasta

 

>metallo-β-lactamase superfamily inner membrane protein YcaI E. coli K12. Version NC_000913.3 GI:556503834
MKITTVGVCIISGIFPLLILPQLPGTLTLAFLTLFACVLAFIPVKTVRYIALTLLFFVWG
ILSAKQILWAGETLTGATQDAIVEITATDGMTTHYGQITHLQGRRIFPASGLVMYGEYLP
QAVCAGQQWSMKLKVRAVHGQLNDGGFDSQRYAIAQHQPLTGRFLQASVIEPNCSLRAQY
LASLQTTLQPYPWNAVILGLGMGERLSVPKEIKNIMRDTGTAHLMAISGLHIAFAALLAA
GLIRSGQIFLPGRWIHWQIPLIGGICCAAFYAWLTGMQPPALRTMVALATWGMLKLSGRQ
WSGWDVWICCLAAILLMDPVAILSQSLWLSAAAVAALIFWYQWFPCPEWQLPPVLRAVVS
LIHLQLGITLLLMPVQIVIFHGISLTSFIANLLAIPLVTFITVPLILAAMVVHLSGPLIL
EQGLWFLADRSLALLFWGLKSLPEGWINIAECWQWLSFSPWFLLVVWRLNAWRTLPAMCV
AGGLLMCWPLWQKPRPDEWQLYMLDVGQGLAMVIARNGKAILYDTGLAWPEGDSGQQLII
PWLHWHNLEPEGVILSHEHLDHRGGLDSILHIWPMLWIRSPLNWEHHQPCVRGEAWQWQG
LRFSAHWPLQGSNDKGNNHSCVVKVDDGTNSILLTGDIEAPAEQKMLSRYWQQVQATLLQ
VPHHGSNTSSSLPLIQRVNGKVALASASRYNAWRLPSNKVKHRYQLQGYQWIDTPHQGQT
TVNFSAQGWRISSLREQILPRWYHQWFGVPVDNG
              
                            

Download fasta file
RegulonDB