RegulonDB RegulonDB 10.9: Amino acid Sequence
isochorismatase family protein YecD Amino Acid Sequence


Size: 188

Fasta

 

>isochorismatase family protein YecD E. coli K12. Version NC_000913.3 GI:556503834
MLELNAKTTALVVIDLQEGILPFAGGPHTADEVVNRAGKLAAKFRASGQPVFLVRVGWSA
DYAEALKQPVDAPSPAKVLPENWWQHPAALGATDSDIEIIKRQWGAFYGTDLELQLRRRG
IDTIVLCGISTNIGVESTARNAWELGFNLVIAEDACSAASAEQHNNSINHIYPRIARVRS
VEEILNAL
              
                            

Download fasta file
RegulonDB