RegulonDB RegulonDB 10.9: Amino acid Sequence
PF09600 family protein YbgE Amino Acid Sequence


Size: 97

Fasta

 

>PF09600 family protein YbgE E. coli K12. Version NC_000913.3 GI:556503834
MSKIIATLYAVMDKRPLRALSFVMALLLAGCMFWDPSRFAAKTSELEIWHGLLLMWAVCA
GVIHGVGFRPQKVLWQGIFCPLLADIVLIVGLIFFFF
              
                            

Download fasta file
RegulonDB