RegulonDB RegulonDB 10.9: Amino acid Sequence
putative cation transport regulator ChaB Amino Acid Sequence


Size: 76

Fasta

 

>putative cation transport regulator ChaB E. coli K12. Version NC_000913.3 GI:556503834
MPYKTKSDLPESVKHVLPSHAQDIYKEAFNSAWDQYKDKEDRRDDASREETAHKVAWAAV
KHEYAKGDDDKWHKKS
              
                            

Download fasta file
RegulonDB