RegulonDB RegulonDB 10.9: Amino acid Sequence
isoaspartyl dipeptidase proenzyme Amino Acid Sequence


Size: 321

Fasta

 

>isoaspartyl dipeptidase proenzyme E. coli K12. Version NC_000913.3 GI:556503834
MGKAVIAIHGGAGAISRAQMSLQQELRYIEALSAIVETGQKMLEAGESALDVVTEAVRLL
EECPLFNAGIGAVFTRDETHELDACVMDGNTLKAGAVAGVSHLRNPVLAARLVMEQSPHV
MMIGEGAENFAFARGMERVSPEIFSTSLRYEQLLAARKEGATVLDHSGAPLDEKQKMGTV
GAVALDLDGNLAAATSTGGMTNKLPGRVGDSPLVGAGCYANNASVAVSCTGTGEVFIRAL
AAYDIAALMDYGGLSLAEACERVVMEKLPALGGSGGLIAIDHEGNVALPFNTEGMYRAWG
YAGDTPTTGIYREKGDTVATQ
              
                            

Download fasta file
RegulonDB