RegulonDB RegulonDB 10.9: Amino acid Sequence
GDP-mannose hydrolase Amino Acid Sequence


Size: 191

Fasta

 

>GDP-mannose hydrolase E. coli K12. Version NC_000913.3 GI:556503834
MTQQITLIKDKILSDNYFTLHNITYDLTRKDGEVIRHKREVYDRGNGATILLYNTKKKTV
VLIRQFRVATWVNGNESGQLIESCAGLLDNDEPEVCIRKEAIEETGYEVGEVRKLFELYM
SPGGVTELIHFFIAEYSDNQRANAGGGVEDEDIEVLELPFSQALEMIKTGEIRDGKTVLL
LNYLQTSHLMD
              
                            

Download fasta file
RegulonDB