RegulonDB RegulonDB 10.9: Amino acid Sequence
galactitol-specific PTS enzyme IIB component Amino Acid Sequence


Size: 94

Fasta

 

>galactitol-specific PTS enzyme IIB component E. coli K12. Version NC_000913.3 GI:556503834
MKRKIIVACGGAVATSTMAAEEIKELCQNHNIPVELIQCRVNEIETYMDGVHLICTTAKV
DRSFGDIPLVHGMPFISGIGIEALQNKILTILQG
              
                            

Download fasta file
RegulonDB