RegulonDB RegulonDB 10.9: Amino acid Sequence
DUF1471 domain-containing protein YbiJ Amino Acid Sequence


Size: 86

Fasta

 

>DUF1471 domain-containing protein YbiJ E. coli K12. Version NC_000913.3 GI:556503834
MKTINTVVAAMALSTLSFGVFAAEPVTASQAQNMNKIGVVSADGASTLDALEAKLAEKAA
AAGASGYSITSATNNNKLSGTAVIYK
              
                            

Download fasta file
RegulonDB