RegulonDB RegulonDB 11.0: Amino acid Sequence
molybdate ABC transporter periplasmic binding protein Amino Acid Sequence


Size: 257

Fasta

 

>molybdate ABC transporter periplasmic binding protein E. coli K12. Version NC_000913.3 GI:556503834
MARKWLNLFAGAALSFAVAGNALADEGKITVFAAASLTNAMQDIATQFKKEKGVDVVSSF
ASSSTLARQIEAGAPADLFISADQKWMDYAVDKKAIDTATRQTLLGNSLVVVAPKASVQK
DFTIDSKTNWTSLLNGGRLAVGDPEHVPAGIYAKEALQKLGAWDTLSPKLAPAEDVRGAL
ALVERNEAPLGIVYGSDAVASKGVKVVATFPEDSHKKVEYPVAVVEGHNNATVKAFYDYL
KGPQAAEIFKRYGFTIK
              
                            

Download fasta file
RegulonDB