RegulonDB RegulonDB 10.9: Amino acid Sequence
DNA-binding transcriptional repressor PuuR Amino Acid Sequence


Size: 185

Fasta

 

>DNA-binding transcriptional repressor PuuR E. coli K12. Version NC_000913.3 GI:556503834
MSDEGLAPGKRLSEIRQQQGLSQRRAAELSGLTHSAISTIEQDKVSPAISTLQKLLKVYG
LSLSEFFSEPEKPDEPQVVINQDDLIEMGSQGVSMKLVHNGNPNRTLAMIFETYQPGTTT
GERIKHQGEEIGTVLEGEIVLTINGQDYHLVAGQSYAINTGIPHSFSNTSAGICRIISAH
TPTTF
              
                            

Download fasta file
RegulonDB