RegulonDB RegulonDB 10.10: Amino acid Sequence
23S rRNA pseudouridine2605 synthase Amino Acid Sequence


Size: 291

Fasta

 

>23S rRNA pseudouridine2605 synthase E. coli K12. Version NC_000913.3 GI:556503834
MSEKLQKVLARAGHGSRREIESIIEAGRVSVDGKIAKLGDRVEVTPGLKIRIDGHLISVR
ESAEQICRVLAYYKPEGELCTRNDPEGRPTVFDRLPKLRGARWIAVGRLDVNTCGLLLFT
TDGELANRLMHPSREVEREYAVRVFGQVDDAKLRDLSRGVQLEDGPAAFKTIKFSGGEGI
NQWYNVTLTEGRNREVRRLWEAVGVQVSRLIRVRYGDIPLPKGLPRGGWTELDLAQTNYL
RELVELPPETSSKVAVEKDRRRMKANQIRRAVKRHSQVSGGRRSGGRNNNG
              
                            

Download fasta file
RegulonDB