RegulonDB RegulonDB 10.9: Amino acid Sequence
intramembrane zinc metalloprotease RseP Amino Acid Sequence


Size: 450

Fasta

 

>intramembrane zinc metalloprotease E. coli K12. Version NC_000913.3 GI:556503834
MLSFLWDLASFIVALGVLITVHEFGHFWVARRCGVRVERFSIGFGKALWRRTDKLGTEYV
IALIPLGGYVKMLDERAEPVVPELRHHAFNNKSVGQRAAIIAAGPVANFIFAIFAYWLVF
IIGVPGVRPVVGEIAANSIAAEAQIAPGTELKAVDGIETPDWDAVRLQLVDKIGDESTTI
TVAPFGSDQRRDVKLDLRHWAFEPDKEDPVSSLGIRPRGPQIEPVLENVQPNSAASKAGL
QAGDRIVKVDGQPLTQWVTFVMLVRDNPGKSLALEIERQGSPLSLTLIPESKPGNGKAIG
FVGIEPKVIPLPDEYKVVRQYGPFNAIVEATDKTWQLMKLTVSMLGKLITGDVKLNNLSG
PISIAKGAGMTAELGVVYYLPFLALISVNLGIINLFPLPVLDGGHLLFLAIEKIKGGPVS
ERVQDFCYRIGSILLVLLMGLALFNDFSRL
              
                            

Download fasta file
RegulonDB