RegulonDB RegulonDB 10.9: Amino acid Sequence
DUF2799 domain-containing lipoprotein YfiL Amino Acid Sequence


Size: 121

Fasta

 

>DUF2799 domain-containing lipoprotein YfiL E. coli K12. Version NC_000913.3 GI:556503834
MMKKFIAPLLALLVSGCQIDPYTHAPTLTSTDWYDVGMEDAISGSAIKDDDAFSDSQADR
GLYLKGYAEGQKKTCQTDFTYARGLSGKSFPASCNNVENASQLHEVWQKGADENASTIRL
N
              
                            

Download fasta file
RegulonDB