RegulonDB RegulonDB 10.9: Amino acid Sequence
NADH:flavorubredoxin reductase Amino Acid Sequence


Size: 377

Fasta

 

>NADH:flavorubredoxin reductase E. coli K12. Version NC_000913.3 GI:556503834
MSNGIVIIGSGFAARQLVKNIRKQDATIPLTLIAADSMDEYNKPDLSHVISQGQRADDLT
RQTAGEFAEQFNLHLFPQTWVTDIDAEARVVKSQNNQWQYDKLVLATGASAFVPPVPGRE
LMLTLNSQQEYRACETQLRDARRVLIVGGGLIGSELAMDFCRAGKAVTLIDNAASILASL
MPPEVSSRLQHRLTEMGVHLLLKSQLQGLEKTDSGIQATLDRQRNIEVDAVIAATGLRPE
TALARRAGLTINRGVCVDSYLQTSNTDIYALGDCAEINGQVLPFLQPIQLSAMVLAKNLL
GNNTPLKLPAMLVKIKTPELPLHLAGETQRQDLRWQINTERQGMVARGVDDADQLRAFVV
SEDRMKEAFGLLKTLPM
              
                            

Download fasta file
RegulonDB