RegulonDB RegulonDB 10.9: Amino acid Sequence
Cys-tRNAPro and Cys-tRNACys deacylase Amino Acid Sequence


Size: 159

Fasta

 

>Cys-tRNAPro and Cys-tRNACys deacylase E. coli K12. Version NC_000913.3 GI:556503834
MTPAVKLLEKNKISFQIHTYEHDPAETNFGDEVVKKLGLNPDQVYKTLLVAVNGDMKHLA
VAVTPVAGQLDLKKVAKALGAKKVEMADPMVAQRSTGYLVGGISPLGQKKRLPTIIDAPA
QEFATIYVSGGKRGLDIELAAGDLAKILDAKFADIARRD
              
                            

Download fasta file
RegulonDB