RegulonDB RegulonDB 10.9: Amino acid Sequence
protein YabQ Amino Acid Sequence


Size: 52

Fasta

 

>protein YabQ E. coli K12. Version NC_000913.3 GI:556503834
MNGATSLYDEVIIINKIPPKKIDTKGVATEEVATKKVLLNKLLTTQLLNEPE
              
                            

Download fasta file
RegulonDB