RegulonDB RegulonDB 10.10: Amino acid Sequence
D-gluconate kinase, thermostable Amino Acid Sequence


Size: 175

Fasta

 

>D-gluconate kinase, thermostable E. coli K12. Version NC_000913.3 GI:556503834
MSTTNHDHHIYVLMGVSGSGKSAVASEVAHQLHAAFLDGDFLHPRRNIEKMASGEPLNDD
DRKPWLQALNDAAFAMQRTNKVSLIVCSALKKHYRDLLREGNPNLSFIYLKGDFDVIESR
LKARKGHFFKTQMLVTQFETLQEPGADETDVLVVDIDQPLEGVVASTIEVIKKGK
              
                            

Download fasta file
RegulonDB