RegulonDB RegulonDB 10.8: Amino acid Sequence
glutamate/aspartate ABC transporter membrane subunit GltK Amino Acid Sequence


Size: 224

Fasta

 

>glutamate/aspartate ABC transporter membrane subunit GltK E. coli K12. Version NC_000913.3 GI:556503834
MYEFDWSSIVPSLPYLLDGLVITLKITVTAVVIGILWGTMLAVMRLSSFAPVAWFAKAYV
NVFRSIPLVMVLLWFYLIVPGFLQNVLGLSPKNDIRLISAMVAFSMFEAAYYSEIIRAGI
QSISRGQSSAALALGMTHWQSMKLIILPQAFRAMVPLLLTQGIVLFQDTSLVYVLSLADF
FRTASTIGERDGTQVEMILFAGFVYFVISLSASLLVSYLKRRTA
              
                            

Download fasta file
RegulonDB