RegulonDB RegulonDB 10.9: Amino acid Sequence
UDP-2,3-diacylglucosamine diphosphatase Amino Acid Sequence


Size: 240

Fasta

 

>UDP-2,3-diacylglucosamine diphosphatase E. coli K12. Version NC_000913.3 GI:556503834
MATLFIADLHLCVEEPAITAGFLRFLAGEARKADALYILGDLFEAWIGDDDPNPLHRKMA
AAIKAVSDSGVPCYFIHGNRDFLLGKRFARESGMTLLPEEKVLELYGRRVLIMHGDTLCT
DDAGYQAFRAKVHKPWLQTLFLALPLFVRKRIAARMRANSKEANSSKSLAIMDVNQNAVV
SAMEKHQVQWLIHGHTHRPAVHELIANQQPAFRVVLGAWHTEGSMVKVTADDVELIHFPF
              
                            

Download fasta file
RegulonDB