RegulonDB RegulonDB 10.9: Amino acid Sequence
DUF1375 domain-containing lipoprotein YceK Amino Acid Sequence


Size: 75

Fasta

 

>DUF1375 domain-containing lipoprotein YceK E. coli K12. Version NC_000913.3 GI:556503834
MRLIVVSIMVTLLSGCGSIISRTIPGQGHGNQYYPGVQWDVRDSAWRYVTILDLPFSLVF
DTLLLPIDIHHGPYE
              
                            

Download fasta file
RegulonDB