RegulonDB RegulonDB 10.9: Amino acid Sequence
lipopolysaccharide assembly protein B Amino Acid Sequence


Size: 389

Fasta

 

>lipopolysaccharide assembly protein B E. coli K12. Version NC_000913.3 GI:556503834
MLELLFLLLPVAAAYGWYMGRRSAQQNKQDEANRLSRDYVAGVNFLLSNQQDKAVDLFLD
MLKEDTGTVEAHLTLGNLFRSRGEVDRAIRIHQTLMESASLTYEQRLLAIQQLGRDYMAA
GLYDRAEDMFNQLTDETDFRIGALQQLLQIYQATSEWQKAIDVAERLVKLGKDKQRVEIA
HFYCELALQHMASDDLDRAMTLLKKGAAADKNSARVSIMMGRVFMAKGEYAKAVESLQRV
ISQDRELVSETLEMLQTCYQQLGKTAEWAEFLQRAVEENTGADAELMLADIIEARDGSEA
AQVYITRQLQRHPTMRVFHKLMDYHLNEAEEGRAKESLMVLRDMVGEKVRSKPRYRCQKC
GFTAYTLYWHCPSCRAWSTIKPIRGLDGL
              
                            

Download fasta file
RegulonDB