RegulonDB RegulonDB 10.9: Amino acid Sequence
PF04307 family inner membrane protein YbcI Amino Acid Sequence


Size: 173

Fasta

 

>PF04307 family inner membrane protein YbcI E. coli K12. Version NC_000913.3 GI:556503834
MPTVITHAAVPLCIGLGLGSKVIPPRLLFAGIILAMLPDADVLSFKFGVAYGNVFGHRGF
THSLVFAFVVPLLCVFIGRRWFRAGLIRCWLFLTVSLLSHSLLDSVTTGGKGVGWLWPWS
DERFFAPWQVIKVAPFALSRYTTPYGHQVIISELMWVWLPGMLLMGMLWWRRR
              
                            

Download fasta file
RegulonDB