RegulonDB RegulonDB 11.1: Amino acid Sequence
cysteine detoxification protein CyuP Amino Acid Sequence


Size: 443

Fasta

 

>putative D/L-serine transporter E. coli K12. Version NC_000913.3 GI:556503834
MEIASNKGVIADASTPAGRAGMSESEWREAIKFDSTDTGWVIMSIGMAIGAGIVFLPVQV
GLMGLWVFLLSSVIGYPAMYLFQRLFINTLAESPECKDYPSVISGYLGKNWGILLGALYF
VMLVIWMFVYSTAITNDSASYLHTFGVTEGLLSDSPFYGLVLICILVAISSRGEKLLFKI
STGMVLTKLLVVAALGVSMVGMWHLYNVGSLPPLGLLVKNAIITLPFTLTSILFIQTLSP
MVISYRSREKSIEVARHKALRAMNIAFGILFVTVFFYAVSFTLAMGHDEAVKAYEQNISA
LAIAAQFISGDGAAWVKVVSVILNIFAVMTAFFGVYLGFREATQGIVMNILRRKMPAEKI
NENLVQRGIMIFAILLAWSAIVLNAPVLSFTSICSPIFGMVGCLIPAWLVYKVPALHKYK
GMSLYLIIVTGLLLCVSPFLAFS
              
                            

Download fasta file
RegulonDB