RegulonDB RegulonDB 10.10: Amino acid Sequence
putative transport protein YrbG Amino Acid Sequence


Size: 325

Fasta

 

>putative transport protein YrbG E. coli K12. Version NC_000913.3 GI:556503834
MLLATALLIVGLLLVVYSADRLVFAASILCRTFGIPPLIIGMTVVSIGTSLPEVIVSLAA
SLHEQRDLAVGTALGSNIINILLILGLAALVRPFTVHSDVLRRELPLMLLVSVVAGSVLY
DGQLSRSDGIFLLFLAVLWLLFIVKLARQAERQGTDSLTREQLAELPRDGGLPVAFLWLG
IALIIMPVATRMVVDNATVLANYFAISELTMGLTAIAIGTSLPELATAIAGVRKGENDIA
VGNIIGANIFNIVIVLGLPALITPGEIDPLAYSRDYSVMLLVSIIFALLCWRRSPQPGRG
VGVLLTGGFIVWLAMLYWLSPILVE
              
                            

Download fasta file
RegulonDB