RegulonDB RegulonDB 10.10: Amino acid Sequence
putative ABC transporter periplasmic binding protein YhdW Amino Acid Sequence


Size: 340

Fasta

 

>putative ABC transporter periplasmic binding protein YhdW E. coli K12. Version NC_000913.3 GI:556503834
MKKMMIATLAAASVLLAVANQALLARRLMPFRKKVLCNAGSVMDYLGSLMPMLTVSFQVL
MLIFVVVLPLLYLVTTRK*NIPRSLQKNASPLYSQGRWICSPVIRPGLHLAMPGWEWHLP
ASLITTALAS*RTIKRG*KARKNWMALPSVFRRVLIPNSTSPTTSRQTI*STHR*LSIAL
TNQRRHWNLVAAIRWPRINHNCMPCASN*ATQLNGLSYRKLSQKNRLVR*FVVAMMNGSR
LYAGRFSPC*MLKRWASIPRTSMKKRLIQQRLIWHICWVKKAITARI*SWIINGPITSSN
RWVTTRKFLSVT*VQKAR*KLNVGKIISGITAVFSTHRPC
              
                            

Download fasta file
RegulonDB