RegulonDB RegulonDB 10.10: Amino acid Sequence
putative ABC transporter membrane subunit YhdX Amino Acid Sequence


Size: 393

Fasta

 

>putative ABC transporter membrane subunit YhdX E. coli K12. Version NC_000913.3 GI:556503834
MSHRRSTVKGSLSFANPTVRAWLFQILAVVAVVGIVGWLFHNTVTNLNNRGITSGFAFLD
RGAGFGIVQHLIDYQQGDTYGRVFIVGLLNTLLVSALCIVFASVLGFFIGLARLSDNWLL
RKLSTIYIEIFRNIPPLLQIFFWYFAVLRNLPGPRQAVSAFDLAFLSNRGLYIPSPQLGD
GFIAFILAVVMAIVLSVGLFRFNKTYQIKTGQLRRTWPIAAVLIIGLPLLAQWLFGAALH
WDVPALRGFNFRGGMVLIPELAALTLALSVYTSAFIAEIIRAGIQAVPYGQHEAARSLGL
PNPVTLRQVIIPQALRVIIPPLTSQYLNIVKNSSLAAAIGYPDMVSLFAGTVLNQTGQAI
ETIAMTMSVYLIISLTISLLMNIYNRRIAIVER
              
                            

Download fasta file
RegulonDB