RegulonDB RegulonDB 10.10: Amino acid Sequence
putative ABC transporter membrane subunit YhdY Amino Acid Sequence


Size: 367

Fasta

 

>putative ABC transporter membrane subunit YhdY E. coli K12. Version NC_000913.3 GI:556503834
MTKVLLSHPPRPASHNSSRAMVWVRKNLFSSWSNSLLTIGCIWLMWELIPPLLNWAFLQA
NWVGSTRADCTKAGACWVFIHERFGQFMYGLYPHDQRWRINLALLIGLVSIAPMFWKILP
HRGRYIAAWAVIYPLIVWWLMYGGFFALERVETRQWGGLTLTLIIASVGIAGALPWGILL
ALGRRSHMPIVRILSVIFIEFWRGVPLITVLFMSSVMLPLFMAEGTSIDKLIRALVGVIL
FQSAYVAEVVRGGLQALPKGQYEAAESLALGYWKTQGLVILPQALKLVIPGLVNTIIALF
KDTSLVIIIGLFDLFSSVQQATVDPAWLGMSTEGYVFAALIYWIFCFSMSRYSQYLEKRF
NTGRTPH
              
                            

Download fasta file
RegulonDB