RegulonDB RegulonDB 10.9: Amino acid Sequence
DUF454 domain-containing inner membrane protein YbaN Amino Acid Sequence


Size: 125

Fasta

 

>DUF454 domain-containing inner membrane protein YbaN E. coli K12. Version NC_000913.3 GI:556503834
MQRIILIIIGWLAVVLGTLGVVLPVLPTTPFILLAAWCFARSSPRFHAWLLYRSWFGSYL
RFWQKHHAMPRGVKPRAILLILLTFAISLWFVQMPWVRIMLLVILACLLFYMWRIPVIDE
KQEKH
              
                            

Download fasta file
RegulonDB