RegulonDB RegulonDB 10.10: Amino acid Sequence
p-aminobenzoyl glutamate:H+ symporter Amino Acid Sequence


Size: 508

Fasta

 

>p-aminobenzoyl glutamate:H+ symporter E. coli K12. Version NC_000913.3 GI:556503834
MSMSSIPSSSQSGKLYGWVERIGNKVPHPFLLFIYLIIVLMVTTAILSAFGVSAKNPTDG
TPVVVKNLLSVEGLHWFLPNVIKNFSGFAPLGAILALVLGAGLAERVGLLPALMVKMASH
VNARYASYMVLFIAFFSHISSDAALVIMPPMGALIFLAVGRHPVAGLLAAIAGVGCGFTA
NLLIVTTDVLLSGISTEAAAAFNPQMHVSVIDNWYFMASSVVVLTIVGGLITDKIIEPRL
GQWQGNSDEKLQTLTESQRFGLRIAGVVSLLFIAAIALMVIPQNGILRDPINHTVMPSPF
IKGIVPLIILFFFVVSLAYGIATRTIRRQADLPHLMIEPMKEMAGFIVMVFPLAQFVAMF
NWSNMGKFIAVGLTDILESSGLSGIPAFVGLALLSSFLCMFIASGSAIWSILAPIFVPMF
MLLGFHPAFAQILFRIADSSVLPLAPVSPFVPLFLGFLQRYKPDAKLGTYYSLVLPYPLI
FLVVWLLMLLAWYLVGLPIGPGIYPRLS
              
                            

Download fasta file
RegulonDB