RegulonDB RegulonDB 10.9: Amino acid Sequence
DUF2594 domain-containing protein YecF Amino Acid Sequence


Size: 74

Fasta

 

>DUF2594 domain-containing protein YecF E. coli K12. Version NC_000913.3 GI:556503834
MSTPDFSTAENNQELANEVSCLKAMLTLMLQAMGQADAGRVMLKMEKQLALIEDETQAAV
FSKTVKQIKQAYRQ
              
                            

Download fasta file
RegulonDB