RegulonDB RegulonDB 10.9: Amino acid Sequence
sulfur transfer protein TusE Amino Acid Sequence


Size: 109

Fasta

 

>sulfur transfer protein TusE E. coli K12. Version NC_000913.3 GI:556503834
MLIFEGKEIETDTEGYLKESSQWSEPLAVVIAENEGISLSPEHWEVVRFVRDFYLEFNTS
PAIRMLVKAMANKFGEEKGNSRYLYRLFPKGPAKQATKIAGLPKPVKCI
              
                            

Download fasta file
RegulonDB