RegulonDB RegulonDB 10.10: Amino acid Sequence
e14 prophage; protein StfP Amino Acid Sequence


Size: 209

Fasta

 

>e14 prophage; protein StfP E. coli K12. Version NC_000913.3 GI:556503834
MHRIDTKTAQKDKFGAGKNGFTRGNPQTGTPATDLDDDYFDMLQEELCSVVEASGASLEK
GRHDQLLTALRALLLSRKNPFGDIKSDGTVQTALENLGLGEGAKLNAATATLGRTGFIAI
PVMIGGIEQSVIIQWGWNAAKASASGGDGNTVVFPVAFNNACVAVVANYDNVSAPINAVA
TGGYTTTSFLLRCAAQTGSYYYNWIAIGY
              
                            

Download fasta file
RegulonDB