RegulonDB RegulonDB 11.0: Amino acid Sequence
putative uncharacterized protein YfaH Amino Acid Sequence


Size: 68

Fasta

 

>putative uncharacterized protein YfaH E. coli K12. Version NC_000913.3 GI:556503834
MNFIRQGLGIALQPELTLKSIAGELCSVPLEPTFYRQISLLAKEKPVEGSPLFLLQMCME
QLVAIGKI
              
                            

Download fasta file
RegulonDB