RegulonDB RegulonDB 10.9: Amino acid Sequence
protein YnaL Amino Acid Sequence


Size: 57

Fasta

 

>protein YnaL E. coli K12. Version NC_000913.3 GI:556503834
MTTLIYLQIPVPEPIPGDPVPVPDPIPRPQPMPDPPPDEEPIKLSHRERRSARIRAC
              
                            

Download fasta file
RegulonDB